Lineage for d9icsa1 (9ics A:9-91)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324209Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 2324612Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 2324613Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins)
  6. 2324614Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species)
    topologically similar to the second domain
  7. 2324615Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries)
    Uniprot P06746
  8. 2324693Domain d9icsa1: 9ics A:9-91 [18012]
    Other proteins in same PDB: d9icsa3, d9icsa4
    protein/DNA complex; complexed with dct, mn, na

Details for d9icsa1

PDB Entry: 9ics (more details), 2.9 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2',3'-dideoxycytidine-5'-triphosphate, soaked in the presence of ddctp and mncl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d9icsa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icsa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]}
etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk
iaekideflatgklrklekirqd

SCOPe Domain Coordinates for d9icsa1:

Click to download the PDB-style file with coordinates for d9icsa1.
(The format of our PDB-style files is described here.)

Timeline for d9icsa1: