| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein cAMP-dependent PK, catalytic subunit [56116] (4 species) AGC group; PKA subfamily; serine/threonine kinase |
| Species Pig (Sus scrofa) [TaxId:9823] [56117] (9 PDB entries) |
| Domain d3l9lb_: 3l9l B: [180119] automated match to d1cmke_ complexed with l9l |
PDB Entry: 3l9l (more details), 2 Å
SCOPe Domain Sequences for d3l9lb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9lb_ d.144.1.7 (B:) cAMP-dependent PK, catalytic subunit {Pig (Sus scrofa) [TaxId: 9823]}
qesvkeflakakedflkkwespaqntahldqferiktlgtgsfgrvmlvkhketgnhyam
kildkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfsh
lrrigrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrv
kgrtwtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekiv
sgkvrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkve
apfipkfkgpgdtsnfddyeeeeirvsinekcgkefsef
Timeline for d3l9lb_: