![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) ![]() has additional strand at N-terminus |
![]() | Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins) |
![]() | Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species) |
![]() | Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries) |
![]() | Domain d3l9ec_: 3l9e C: [180111] automated match to d1to4a_ complexed with zn |
PDB Entry: 3l9e (more details), 2.05 Å
SCOPe Domain Sequences for d3l9ec_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l9ec_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]} mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh adpddlglgghelskttgnaggriacgviglaki
Timeline for d3l9ec_: