Lineage for d3l9eb_ (3l9e B:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 936733Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 936734Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 936747Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 937117Species Silkworm (Bombyx mori) [TaxId:7091] [189285] (2 PDB entries)
  8. 937121Domain d3l9eb_: 3l9e B: [180110]
    automated match to d1to4a_
    complexed with zn

Details for d3l9eb_

PDB Entry: 3l9e (more details), 2.05 Å

PDB Description: Crystal structures of holo and Cu-deficient Cu/ZnSOD from the silkworm Bombyx mori and the implications in Amyotrophic lateral sclerosis
PDB Compounds: (B:) Superoxide dismutase [Cu-Zn]

SCOPe Domain Sequences for d3l9eb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l9eb_ b.1.8.1 (B:) Cu,Zn superoxide dismutase, SOD {Silkworm (Bombyx mori) [TaxId: 7091]}
mpakavcvlrgdvsgtvffdqqdekspvvvsgevqgltkgkhgfhvhefgdntngctsag
ahfnpekqdhggpssavrhvgdlgnieaiedsgvtkvsiqdsqislhgpnsiigrtlvvh
adpddlglgghelskttgnaggriacgviglaki

SCOPe Domain Coordinates for d3l9eb_:

Click to download the PDB-style file with coordinates for d3l9eb_.
(The format of our PDB-style files is described here.)

Timeline for d3l9eb_: