Lineage for d3l93a1 (3l93 A:1-159)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) 
Protein automated matches [190964] (6 species)
not a true protein
Species Yersinia pestis [TaxId:214092] [189196] (2 PDB entries) 
Domain d3l93a1: 3l93 A:1-159 [180100]
Other proteins in same PDB: d3l93a2
automated match to d1gn8a_
complexed with fmt
Details for d3l93a1
PDB Entry: 3l93 (more details), 2.16 Å
PDB Description: phosphopantetheine adenylyltransferase from yersinia pestis.
PDB Compounds: (A:) phosphopantetheine adenylyltransferaseSCOPe Domain Sequences for d3l93a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l93a1 c.26.1.3 (A:1-159) automated matches {Yersinia pestis [TaxId: 214092]}
mitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkvta
plknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvflip
sekwsfissslvkevarhggditpflpkpvtkallakla
SCOPe Domain Coordinates for d3l93a1:
Click to download the PDB-style file with coordinates for d3l93a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3l93a1:
- d3l93a1 first appeared in SCOPe 2.01, called d3l93a_
- d3l93a1 appears in SCOPe 2.07
View in 3D
