| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) ![]() |
| Family c.26.1.3: Adenylyltransferase [52397] (6 proteins) |
| Protein automated matches [190964] (6 species) not a true protein |
| Species Yersinia pestis [TaxId:214092] [189196] (2 PDB entries) |
| Domain d3l92a_: 3l92 A: [180099] automated match to d1gn8a_ complexed with coa |
PDB Entry: 3l92 (more details), 1.89 Å
SCOPe Domain Sequences for d3l92a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l92a_ c.26.1.3 (A:) automated matches {Yersinia pestis [TaxId: 214092]}
mitkaiypgtfdpitnghldlvtrasamfshvilaiadssskkpmftldervalakkvta
plknvevlgfselmaefakkhnanilvrglrsvsdfeyewqlanmnrhlmpklesvflip
sekwsfissslvkevarhggditpflpkpvtkallakla
Timeline for d3l92a_: