Lineage for d3l8ub_ (3l8u B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921212Fold c.116: alpha/beta knot [75216] (1 superfamily)
    core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot
  4. 2921213Superfamily c.116.1: alpha/beta knot [75217] (9 families) (S)
    known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
    all known members have dimeric structures
  5. 2921420Family c.116.1.0: automated matches [191557] (1 protein)
    not a true family
  6. 2921421Protein automated matches [190961] (22 species)
    not a true protein
  7. 2921616Species Streptococcus mutans [TaxId:210007] [189590] (1 PDB entry)
  8. 2921618Domain d3l8ub_: 3l8u B: [180094]
    automated match to d1j85a_

Details for d3l8ub_

PDB Entry: 3l8u (more details), 2 Å

PDB Description: Crystal structure of SMU.1707c, a putative rRNA methyltransferase from streptococcus mutans UA159
PDB Compounds: (B:) Putative rRNA methylase

SCOPe Domain Sequences for d3l8ub_:

Sequence, based on SEQRES records: (download)

>d3l8ub_ c.116.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmkragldywdkldvh
fydslndfmnicsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsek
alripvndqhvrslnlsntvcmivyealrqqdfiglelshtya

Sequence, based on observed residues (ATOM records): (download)

>d3l8ub_ c.116.1.0 (B:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmldvhfydslndfmn
icsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsekalripvndqh
vrslnlsntvcmivyealrqqdfiglelshtya

SCOPe Domain Coordinates for d3l8ub_:

Click to download the PDB-style file with coordinates for d3l8ub_.
(The format of our PDB-style files is described here.)

Timeline for d3l8ub_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3l8ua_