SCOPe 2.06: Domain d3l8ua_: 3l8u A:

Lineage for d3l8ua_ (3l8u A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.116: alpha/beta knot [75216] (1 superfamily)
   core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot

4. Superfamily c.116.1: alpha/beta knot [75217] (9 families)
   known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily
   all known members have dimeric structures

5. Family c.116.1.0: automated matches [191557] (1 protein)
   not a true family

6. Protein automated matches [190961] (16 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:210007] [189590] (1 PDB entry)

8. Domain d3l8ua_: 3l8u A: [180093]
   automated match to d1j85a_

Details for d3l8ua_

PDB Entry: 3l8u, 2 Å

PDB Description: Crystal structure of SMU.1707c, a putative rRNA methyltransferase from streptococcus mutans UA159

PDB Compounds: (A:) Putative rRNA methylase

SCOPe Domain Sequences for d3l8ua_:

Sequence, based on SEQRES records:

>d3l8ua_ c.116.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmkragldywdkldvh
fydslndfmnicsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsek
alripvndqhvrslnlsntvcmivyealrqqdfiglelsht

Sequence, based on observed residues (ATOM records):

>d3l8ua_ c.116.1.0 (A:) automated matches {Streptococcus mutans [TaxId: 210007]}
lgrnhvvlfqpqipantgniartcaatntslhiirpmgfpiddkkmywdldvhfydslnd
fmnicsgklhlitkfanktysdenyddsehhyflfgredkglpeefmrqhsekalripvn
dqhvrslnlsntvcmivyealrqqdfiglelsht

Timeline for d3l8ua_:

• d3l8ua_ first appeared in SCOPe 2.01
  
• d3l8ua_ appears in SCOPe 2.05
  
• d3l8ua_ appears in SCOPe 2.07
  
• d3l8ua_ appears in the current release, SCOPe 2.08