SCOPe 2.01: Domain d3l8rd_: 3l8r D:

Lineage for d3l8rd_ (3l8r D:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families)

5. Family a.7.2.0: automated matches [191602] (1 protein)
   not a true family

6. Protein automated matches [191097] (2 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [189195] (1 PDB entry)

8. Domain d3l8rd_: 3l8r D: [180087]
   automated match to d1e2aa_

Details for d3l8rd_

PDB Entry: 3l8r, 2.5 Å

PDB Description: The crystal structure of PtcA from S. mutans

PDB Compounds: (D:) Putative PTS system, cellobiose-specific IIA component

SCOPe Domain Sequences for d3l8rd_:

Sequence; same for both SEQRES and ATOM records:

>d3l8rd_ a.7.2.0 (D:) automated matches {Streptococcus mutans [TaxId: 1309]}
mnteelqvaafeiilnsgnarsivheafdamreknyilaeqklqeandellkahqaqtdl
lqeyasgteikieiimvhaqdhlmttmtlrevaiemlelykk

Timeline for d3l8rd_:

• d3l8rd_ is new in SCOPe 2.01-stable
  
• d3l8rd_ appears in SCOPe 2.02
  
• d3l8rd_ appears in the current release, SCOPe 2.08