| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.7: Spectrin repeat-like [46965] (16 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down |
Superfamily a.7.2: Enzyme IIa from lactose specific PTS, IIa-lac [46973] (2 families) ![]() |
| Family a.7.2.0: automated matches [191602] (1 protein) not a true family |
| Protein automated matches [191097] (4 species) not a true protein |
| Species Streptococcus mutans [TaxId:1309] [189195] (1 PDB entry) |
| Domain d3l8rb_: 3l8r B: [180085] automated match to d1e2aa_ |
PDB Entry: 3l8r (more details), 2.5 Å
SCOPe Domain Sequences for d3l8rb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l8rb_ a.7.2.0 (B:) automated matches {Streptococcus mutans [TaxId: 1309]}
mnteelqvaafeiilnsgnarsivheafdamreknyilaeqklqeandellkahqaqtdl
lqeyasgteikieiimvhaqdhlmttmtlrevaiemlelykk
Timeline for d3l8rb_: