SCOPe 2.06: Domain d3l8fa_: 3l8f A:

Lineage for d3l8fa_ (3l8f A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.19: Histidinol phosphatase-like [142177] (3 proteins)
   no insertion subdomains

6. Protein D,D-heptose 1,7-bisphosphate phosphatase GmhB [159534] (1 species)

7. Species Escherichia coli [TaxId:562] [159535] (8 PDB entries)
   Uniprot P63228 4-185

8. Domain d3l8fa_: 3l8f A: [180082]
   automated match to d2gmwa1
   complexed with mg, po4, zn

Details for d3l8fa_

PDB Entry: 3l8f, 1.79 Å

PDB Description: crystal structure of d,d-heptose 1.7-bisphosphate phosphatase from e. coli complexed with magnesium and phosphate

PDB Compounds: (A:) D,D-heptose 1,7-bisphosphate phosphatase

SCOPe Domain Sequences for d3l8fa_:

Sequence; same for both SEQRES and ATOM records:

>d3l8fa_ c.108.1.19 (A:) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]}
svpaifldrdgtinvdhgyvheidnfefidgvidamrelkkmgfalvvvtnqsgiargkf
teaqfetltewmdwsladrdvdldgiyycphhpqgsveefrqvcdcrkphpgmllsardy
lhidmaasymvgdkledmqaavaanvgtkvlvrtgkpitpeaenaadwvlnsladlpqai
kkq

Timeline for d3l8fa_:

• d3l8fa_ first appeared in SCOPe 2.01
  
• d3l8fa_ appears in SCOPe 2.05
  
• d3l8fa_ appears in SCOPe 2.07
  
• d3l8fa_ appears in the current release, SCOPe 2.08