![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.60: SAM domain-like [47768] (17 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
![]() | Superfamily a.60.6: DNA polymerase beta, N-terminal domain-like [47802] (2 families) ![]() contains one classic and one pseudo HhH motifs |
![]() | Family a.60.6.1: DNA polymerase beta, N-terminal domain-like [47803] (3 proteins) |
![]() | Protein DNA polymerase beta, N-terminal (8 kD)-domain [47804] (2 species) topologically similar to the second domain |
![]() | Species Human (Homo sapiens) [TaxId:9606] [47805] (145 PDB entries) Uniprot P06746 |
![]() | Domain d8icsa1: 8ics A:9-91 [18008] Other proteins in same PDB: d8icsa3, d8icsa4 protein/DNA complex; complexed with dcp, mn, na |
PDB Entry: 8ics (more details), 2.9 Å
SCOPe Domain Sequences for d8icsa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icsa1 a.60.6.1 (A:9-91) DNA polymerase beta, N-terminal (8 kD)-domain {Human (Homo sapiens) [TaxId: 9606]} etlnggitdmltelanfeknvsqaihkynayrkaasviakyphkiksgaeakklpgvgtk iaekideflatgklrklekirqd
Timeline for d8icsa1: