Lineage for d3l88d_ (3l88 D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2776827Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2776828Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2777097Family b.21.1.0: automated matches [191353] (1 protein)
    not a true family
  6. 2777098Protein automated matches [190378] (9 species)
    not a true protein
  7. 2777106Species Human adenovirus 21 [TaxId:32608] [189307] (1 PDB entry)
  8. 2777110Domain d3l88d_: 3l88 D: [180071]
    automated match to d2o39a1
    complexed with cl, gol, na

Details for d3l88d_

PDB Entry: 3l88 (more details), 2.5 Å

PDB Description: Crystal structure of the human Adenovirus type 21 fiber knob
PDB Compounds: (D:) fiber protein

SCOPe Domain Sequences for d3l88d_:

Sequence, based on SEQRES records: (download)

>d3l88d_ b.21.1.0 (D:) automated matches {Human adenovirus 21 [TaxId: 32608]}
intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
tiqlrlyfdssgnlltdesnlkiplknksstatseaatsskafmpsttaypfntttrdse
nyihgicyymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatltt
spfffsyired

Sequence, based on observed residues (ATOM records): (download)

>d3l88d_ b.21.1.0 (D:) automated matches {Human adenovirus 21 [TaxId: 32608]}
intlwtgikpppncqiventdtndgkltlvlvkngglvngyvslvgvsdtvnqmftqksa
tiqlrlyfdssgnlltdesnlkiplknksssskafmpsttaypfntttrdsenyihgicy
ymtsydrslvplnisimlnsrtissnvayaiqfewnlnakespesniatlttspfffsyi
red

SCOPe Domain Coordinates for d3l88d_:

Click to download the PDB-style file with coordinates for d3l88d_.
(The format of our PDB-style files is described here.)

Timeline for d3l88d_: