Lineage for d3l7qg_ (3l7q G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2958619Superfamily d.79.1: YjgF-like [55298] (4 families) (S)
    forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2958881Family d.79.1.0: automated matches [191544] (1 protein)
    not a true family
  6. 2958882Protein automated matches [190935] (24 species)
    not a true protein
  7. 2959058Species Streptococcus mutans [TaxId:210007] [189584] (1 PDB entry)
  8. 2959065Domain d3l7qg_: 3l7q G: [180064]
    automated match to d1qd9a_

Details for d3l7qg_

PDB Entry: 3l7q (more details), 2.5 Å

PDB Description: crystal structure of aldr from streptococcus mutans
PDB Compounds: (G:) Putative translation initiation inhibitor, aldR regulator-like protein

SCOPe Domain Sequences for d3l7qg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l7qg_ d.79.1.0 (G:) automated matches {Streptococcus mutans [TaxId: 210007]}
kkihtdkapaaigpyvqgkivgnllfasgqvplspetgqvigttieeqtqqvlknisail
teagtdfdhvvkttcflsdiddfvpfnevyatafksdfparsavevarlpkdvkieievi
aeli

SCOPe Domain Coordinates for d3l7qg_:

Click to download the PDB-style file with coordinates for d3l7qg_.
(The format of our PDB-style files is described here.)

Timeline for d3l7qg_: