![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.1: YjgF-like [55298] (4 families) ![]() forms trimers with three closely packed beta-sheets; possibly related to the IspF (d.79.5) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.1.0: automated matches [191544] (1 protein) not a true family |
![]() | Protein automated matches [190935] (24 species) not a true protein |
![]() | Species Streptococcus mutans [TaxId:210007] [189584] (1 PDB entry) |
![]() | Domain d3l7qe_: 3l7q E: [180062] automated match to d1qd9a_ |
PDB Entry: 3l7q (more details), 2.5 Å
SCOPe Domain Sequences for d3l7qe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l7qe_ d.79.1.0 (E:) automated matches {Streptococcus mutans [TaxId: 210007]} kkihtdkapaaigpyvqgkivgnllfasgqvplspetgqvigttieeqtqqvlknisail teagtdfdhvvkttcflsdiddfvpfnevyatafksdfparsavevarlpkdvkieievi aeli
Timeline for d3l7qe_: