SCOPe 2.05: Domain d3l7pe_: 3l7p E:

Lineage for d3l7pe_ (3l7p E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.5: GlnB-like [54913] (6 families)
   form timeric structures with the orthogonally packed beta-sheets

5. Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)

6. Protein automated matches [190670] (6 species)
   not a true protein

7. Species Streptococcus mutans [TaxId:1309] [189585] (1 PDB entry)

8. Domain d3l7pe_: 3l7p E: [180056]
   automated match to d1qy7a_

Details for d3l7pe_

PDB Entry: 3l7p, 2 Å

PDB Description: Crystal structure of SMU.1657c, Putative nitrogen regulatory protein PII from streptococcus mutans

PDB Compounds: (E:) Putative nitrogen regulatory protein PII

SCOPe Domain Sequences for d3l7pe_:

Sequence, based on SEQRES records:

>d3l7pe_ d.58.5.1 (E:) automated matches {Streptococcus mutans [TaxId: 1309]}
smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnqrgyteyvrgqkitptllak
vkveivahdaaveemittisqavktgevgdgkifvspvdeivri

Sequence, based on observed residues (ATOM records):

>d3l7pe_ d.58.5.1 (E:) automated matches {Streptococcus mutans [TaxId: 1309]}
smkkieaiirsdkledlkaalvqsgfikgmtisqvlgfgnptllakvkveivahdaavee
mittisqavkdgkifvspvdeivri

Timeline for d3l7pe_:

• d3l7pe_ first appeared in SCOPe 2.01
  
• d3l7pe_ appears in SCOPe 2.04
  
• d3l7pe_ is called d3l7pe1 in SCOPe 2.06
  
• d3l7pe_ appears in the current release, SCOPe 2.08, called d3l7pe1