Lineage for d3l75w_ (3l75 W:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697651Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1698406Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1698407Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1698442Protein automated matches [190326] (3 species)
    not a true protein
  7. 1698451Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries)
  8. 1698453Domain d3l75w_: 3l75 W: [180040]
    Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75f_, d3l75g_, d3l75h_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75s_, d3l75t_, d3l75u_
    automated match to d1bccj_
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75w_

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (W:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l75w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75w_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease

SCOPe Domain Coordinates for d3l75w_:

Click to download the PDB-style file with coordinates for d3l75w_.
(The format of our PDB-style files is described here.)

Timeline for d3l75w_: