![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
![]() | Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) ![]() automatically mapped to Pfam PF02939 |
![]() | Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
![]() | Protein automated matches [191133] (1 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
![]() | Domain d3l75t_: 3l75 T: [180038] Other proteins in same PDB: d3l75a1, d3l75a2, d3l75b1, d3l75b2, d3l75c1, d3l75c2, d3l75d1, d3l75d2, d3l75f_, d3l75h_, d3l75j_, d3l75n1, d3l75n2, d3l75o1, d3l75o2, d3l75p1, d3l75p2, d3l75q1, d3l75q2, d3l75s_, d3l75u_, d3l75w_ automated match to d1be3g_ complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq |
PDB Entry: 3l75 (more details), 2.79 Å
SCOPe Domain Sequences for d3l75t_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l75t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw gtqeferlkrknpadyen
Timeline for d3l75t_: