Lineage for d3l75t_ (3l75 T:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059912Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
  5. 1059913Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 1059953Protein automated matches [191133] (1 species)
    not a true protein
  7. 1059954Species Chicken (Gallus gallus) [TaxId:9031] [189229] (4 PDB entries)
  8. 1059956Domain d3l75t_: 3l75 T: [180038]
    Other proteins in same PDB: d3l75f_, d3l75h_, d3l75j_, d3l75s_, d3l75u_, d3l75w_
    automated match to d1be3g_
    complexed with azi, bog, cdl, fes, fnm, hec, hem, pee, unl, uq

Details for d3l75t_

PDB Entry: 3l75 (more details), 2.79 Å

PDB Description: cytochrome bc1 complex from chicken with fenamidone bound
PDB Compounds: (T:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l75t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l75t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyen

SCOPe Domain Coordinates for d3l75t_:

Click to download the PDB-style file with coordinates for d3l75t_.
(The format of our PDB-style files is described here.)

Timeline for d3l75t_: