SCOPe 2.02: Domain d3l74u_: 3l74 U:

Lineage for d3l74u_ (3l74 U:)

1. Root: SCOPe 2.02

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189230] (4 PDB entries)

8. Domain d3l74u_: 3l74 U: [180031]
   Other proteins in same PDB: d3l74f_, d3l74g_, d3l74j_, d3l74s_, d3l74t_, d3l74w_
   automated match to d1bcch_
   complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq

Details for d3l74u_

PDB Entry: 3l74, 2.76 Å

PDB Description: cytochrome bc1 complex from chicken with famoxadone bound

PDB Compounds: (U:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l74u_:

Sequence; same for both SEQRES and ATOM records:

>d3l74u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk

Timeline for d3l74u_:

• d3l74u_ first appeared in SCOPe 2.01
  
• d3l74u_ appears in SCOPe 2.03
  
• d3l74u_ appears in the current release, SCOPe 2.08