Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) automatically mapped to Pfam PF02939 |
Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins) |
Protein automated matches [191133] (1 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries) |
Domain d3l74g_: 3l74 G: [180026] Other proteins in same PDB: d3l74a1, d3l74a2, d3l74b1, d3l74b2, d3l74c1, d3l74c2, d3l74d1, d3l74d2, d3l74f_, d3l74h_, d3l74j_, d3l74n1, d3l74n2, d3l74o1, d3l74o2, d3l74p1, d3l74p2, d3l74q1, d3l74q2, d3l74s_, d3l74u_, d3l74w_ automated match to d1be3g_ complexed with azi, bog, cdl, fes, fmx, hec, hem, pee, unl, uq |
PDB Entry: 3l74 (more details), 2.76 Å
SCOPe Domain Sequences for d3l74g_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l74g_ f.23.13.1 (G:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} gihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllys wgtqeferlkrknpadyendq
Timeline for d3l74g_: