Lineage for d3l71w_ (3l71 W:)

  1. Root: SCOPe 2.01
  2. 1058004Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1059389Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1059963Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
  5. 1059964Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1059999Protein automated matches [190326] (3 species)
    not a true protein
  7. 1060002Species Chicken (Gallus gallus) [TaxId:9031] [189231] (4 PDB entries)
  8. 1060008Domain d3l71w_: 3l71 W: [180024]
    Other proteins in same PDB: d3l71f_, d3l71g_, d3l71h_, d3l71s_, d3l71t_, d3l71u_
    automated match to d1bccj_
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71w_

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (W:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l71w_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71w_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease

SCOPe Domain Coordinates for d3l71w_:

Click to download the PDB-style file with coordinates for d3l71w_.
(The format of our PDB-style files is described here.)

Timeline for d3l71w_: