Lineage for d3l71u_ (3l71 U:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633065Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2633066Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family) (S)
    location - intermembrane side of the bc1 complex
    automatically mapped to Pfam PF02320
  5. 2633067Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
    "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1
  6. 2633101Protein automated matches [190042] (4 species)
    not a true protein
  7. 2633102Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)
  8. 2633110Domain d3l71u_: 3l71 U: [180023]
    Other proteins in same PDB: d3l71a1, d3l71a2, d3l71b1, d3l71b2, d3l71c1, d3l71c2, d3l71d1, d3l71d2, d3l71e1, d3l71e2, d3l71f_, d3l71g_, d3l71j_, d3l71n1, d3l71n2, d3l71o1, d3l71o2, d3l71p1, d3l71p2, d3l71q1, d3l71q2, d3l71r1, d3l71r2, d3l71s_, d3l71t_, d3l71w_
    automated match to d1bcch_
    complexed with azo, bog, cdl, fes, gol, hec, hem, pee, uq

Details for d3l71u_

PDB Entry: 3l71 (more details), 2.84 Å

PDB Description: cytochrome bc1 complex from chicken with azoxystrobin bound
PDB Compounds: (U:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l71u_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l71u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk

SCOPe Domain Coordinates for d3l71u_:

Click to download the PDB-style file with coordinates for d3l71u_.
(The format of our PDB-style files is described here.)

Timeline for d3l71u_: