| Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
| Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
| Protein automated matches [190326] (4 species) not a true protein |
| Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries) |
| Domain d3l70w_: 3l70 W: [180016] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_ automated match to d1bccj_ complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70w_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
Timeline for d3l70w_:
View in 3DDomains from other chains: (mouse over for more information) d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_ |