SCOPe 2.07: Domain d3l70u_: 3l70 U:

Lineage for d3l70u_ (3l70 U:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex
   automatically mapped to Pfam PF02320

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (2 proteins)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein automated matches [190042] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189230] (8 PDB entries)

8. Domain d3l70u_: 3l70 U: [180015]
   Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70w_
   automated match to d1bcch_
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70u_

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (U:) Mitochondrial ubiquinol-cytochrome c reductase 11 kda protein, complex iii subunit viii

SCOPe Domain Sequences for d3l70u_:

Sequence; same for both SEQRES and ATOM records:

>d3l70u_ f.28.1.1 (U:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elvdplttirehceqtekcvkarerlelcdarvssrshteeqcteelfdflhardhcvah
klfnklk

Timeline for d3l70u_:

• d3l70u_ first appeared in SCOPe 2.01
  
• d3l70u_ appears in SCOPe 2.06
  
• d3l70u_ appears in the current release, SCOPe 2.08