Lineage for d3l70j_ (3l70 J:)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1456646Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
    not a true fold
  4. 1457317Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) (S)
    automatically mapped to Pfam PF05365
  5. 1457318Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)
  6. 1457353Protein automated matches [190326] (3 species)
    not a true protein
  7. 1457361Species Chicken (Gallus gallus) [TaxId:9031] [189231] (4 PDB entries)
  8. 1457368Domain d3l70j_: 3l70 J: [180012]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70f_, d3l70g_, d3l70h_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70s_, d3l70t_, d3l70u_
    automated match to d1bccj_
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70j_

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (J:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l70j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
e

SCOPe Domain Coordinates for d3l70j_:

Click to download the PDB-style file with coordinates for d3l70j_.
(The format of our PDB-style files is described here.)

Timeline for d3l70j_: