SCOPe 2.01: Domain d3l70j_: 3l70 J:

Lineage for d3l70j_ (3l70 J:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein automated matches [190326] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189231] (4 PDB entries)

8. Domain d3l70j_: 3l70 J: [180012]
   Other proteins in same PDB: d3l70f_, d3l70g_, d3l70h_, d3l70s_, d3l70t_, d3l70u_
   automated match to d1bccj_
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70j_

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (J:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l70j_:

Sequence; same for both SEQRES and ATOM records:

>d3l70j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
e

Timeline for d3l70j_:

• d3l70j_ is new in SCOPe 2.01-stable
  
• d3l70j_ appears in SCOPe 2.02
  
• d3l70j_ appears in the current release, SCOPe 2.08