SCOPe 2.01: Domain d3l6tb_: 3l6t B:

Lineage for d3l6tb_ (3l6t B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
   alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325

4. Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families)

5. Family d.89.1.0: automated matches [191630] (1 protein)
   not a true family

6. Protein automated matches [191159] (1 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [189342] (2 PDB entries)

8. Domain d3l6tb_: 3l6t B: [180008]
   automated match to d1osbc_
   complexed with cit, cl, edo, mg, na, ni, po4; mutant

Details for d3l6tb_

PDB Entry: 3l6t, 1.93 Å

PDB Description: crystal structure of an n-terminal mutant of the plasmid pcu1 trai relaxase domain

PDB Compounds: (B:) Mobilization protein TraI

SCOPe Domain Sequences for d3l6tb_:

Sequence, based on SEQRES records:

>d3l6tb_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
snamldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfke
llvgeidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaav
reaeklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwr
alkndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmah

Sequence, based on observed residues (ATOM records):

>d3l6tb_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
snamldittitrqnvtsvvftswqgtgaealglsgdvesarfkellvgeidtfthmqrhk
kerlgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtq
ntnnlvvatfrhetldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqela
leltkagyelrynsknntfdmah

Timeline for d3l6tb_:

• d3l6tb_ is new in SCOPe 2.01-stable
  
• d3l6tb_ appears in SCOPe 2.02
  
• d3l6tb_ appears in the current release, SCOPe 2.08, called d3l6tb1