Lineage for d3l6tb_ (3l6t B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1034235Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 1034236Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 1034310Family d.89.1.0: automated matches [191630] (1 protein)
    not a true family
  6. 1034311Protein automated matches [191159] (1 species)
    not a true protein
  7. 1034312Species Escherichia coli [TaxId:562] [189342] (2 PDB entries)
  8. 1034314Domain d3l6tb_: 3l6t B: [180008]
    automated match to d1osbc_
    complexed with cit, cl, edo, mg, na, ni, po4; mutant

Details for d3l6tb_

PDB Entry: 3l6t (more details), 1.93 Å

PDB Description: crystal structure of an n-terminal mutant of the plasmid pcu1 trai relaxase domain
PDB Compounds: (B:) Mobilization protein TraI

SCOPe Domain Sequences for d3l6tb_:

Sequence, based on SEQRES records: (download)

>d3l6tb_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
snamldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfke
llvgeidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaav
reaeklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwr
alkndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmah

Sequence, based on observed residues (ATOM records): (download)

>d3l6tb_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
snamldittitrqnvtsvvftswqgtgaealglsgdvesarfkellvgeidtfthmqrhk
kerlgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtq
ntnnlvvatfrhetldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqela
leltkagyelrynsknntfdmah

SCOPe Domain Coordinates for d3l6tb_:

Click to download the PDB-style file with coordinates for d3l6tb_.
(The format of our PDB-style files is described here.)

Timeline for d3l6tb_: