Lineage for d3l6tb1 (3l6t B:1-223)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963262Family d.89.1.0: automated matches [191630] (1 protein)
    not a true family
  6. 2963263Protein automated matches [191159] (3 species)
    not a true protein
  7. 2963264Species Escherichia coli [TaxId:562] [189342] (2 PDB entries)
  8. 2963268Domain d3l6tb1: 3l6t B:1-223 [180008]
    Other proteins in same PDB: d3l6ta2, d3l6tb2
    automated match to d1osbc_
    complexed with cit, cl, edo, mg, na, ni, po4; mutant

Details for d3l6tb1

PDB Entry: 3l6t (more details), 1.93 Å

PDB Description: crystal structure of an n-terminal mutant of the plasmid pcu1 trai relaxase domain
PDB Compounds: (B:) Mobilization protein TraI

SCOPe Domain Sequences for d3l6tb1:

Sequence, based on SEQRES records: (download)

>d3l6tb1 d.89.1.0 (B:1-223) automated matches {Escherichia coli [TaxId: 562]}
mldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfkellv
geidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaavrea
eklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwralk
ndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmah

Sequence, based on observed residues (ATOM records): (download)

>d3l6tb1 d.89.1.0 (B:1-223) automated matches {Escherichia coli [TaxId: 562]}
mldittitrqnvtsvvftswqgtgaealglsgdvesarfkellvgeidtfthmqrhkker
lgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtqntn
nlvvatfrhetldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqelalel
tkagyelrynsknntfdmah

SCOPe Domain Coordinates for d3l6tb1:

Click to download the PDB-style file with coordinates for d3l6tb1.
(The format of our PDB-style files is described here.)

Timeline for d3l6tb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3l6tb2