Lineage for d3l6ra_ (3l6r A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2139769Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 2139770Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 2140083Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 2140084Protein automated matches [190215] (32 species)
    not a true protein
  7. 2140126Species Human (Homo sapiens) [TaxId:9606] [188411] (3 PDB entries)
  8. 2140128Domain d3l6ra_: 3l6r A: [180006]
    automated match to d1v71a1
    complexed with mli, mn

Details for d3l6ra_

PDB Entry: 3l6r (more details), 1.7 Å

PDB Description: The structure of mammalian serine racemase: Evidence for conformational changes upon inhibitor binding
PDB Compounds: (A:) Serine racemase

SCOPe Domain Sequences for d3l6ra_:

Sequence, based on SEQRES records: (download)

>d3l6ra_ c.79.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqydisfadvekahinirdsihltpvltssilnqltgrnlffkcelfqktgsfkirgaln
avrslvpdalerkpkavvthssgnhgqaltyaaklegipayivvpqtapdckklaiqayg
asivycepsdesrenvakrvteetegimvhpnqepaviagqgtialevlnqvplvdalvv
pvggggmlagiaitvkalkpsvkvyaaepsnaddcyqsklkgklmpnlyppetiadgvks
siglntwpiirdlvddiftvtedeikcatqlvwermkllieptagvgvaavlsqhfqtvs
pevknicivlsggnvdltssitwvkqa

Sequence, based on observed residues (ATOM records): (download)

>d3l6ra_ c.79.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aqydisfadvekahinirdsihltpvltssilnqltgrnlffkcelfqktgsfkirgaln
avrslvpkavvthssgnhgqaltyaaklegipayivvpqtapdckklaiqaygasivyce
psdesrenvakrvteetegimvhpnqepaviagqgtialevlnqvplvdalvvpvggggm
lagiaitvkalkpsvkvyaaepsnaddcyqsklkgklmpnlyppetiadgvkssiglntw
piirdlvddiftvtedeikcatqlvwermkllieptagvgvaavlsqhfqtvspevknic
ivlsggnvdltssitwvkqa

SCOPe Domain Coordinates for d3l6ra_:

Click to download the PDB-style file with coordinates for d3l6ra_.
(The format of our PDB-style files is described here.)

Timeline for d3l6ra_: