Lineage for d3l6na_ (3l6n A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224808Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 1224809Protein automated matches [190418] (5 species)
    not a true protein
  7. 1224812Species Chryseobacterium indologenes [TaxId:253] [189306] (1 PDB entry)
  8. 1224813Domain d3l6na_: 3l6n A: [180005]
    automated match to d1m2xa_
    complexed with so4, zn

Details for d3l6na_

PDB Entry: 3l6n (more details), 1.65 Å

PDB Description: crystal structure of metallo-beta-lactamase ind-7
PDB Compounds: (A:) metallo-beta-lactamase

SCOPe Domain Sequences for d3l6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l6na_ d.157.1.0 (A:) automated matches {Chryseobacterium indologenes [TaxId: 253]}
qvkdfvieppiknnlhiyktfgvfggkeysansmylvtkkgvvlfdvpwekvqyqslmdt
ikkrhnlpvvavfathshddragdlsffnnkgiktyataktneflkkdgkatsteiiktg
kpyriggeefvvdflgeghtadnvvvwfpkynvldggclvksnsatdlgyikeanveqwp
ktinklkakyskatliipghdewkggghvehtlellnk

SCOPe Domain Coordinates for d3l6na_:

Click to download the PDB-style file with coordinates for d3l6na_.
(The format of our PDB-style files is described here.)

Timeline for d3l6na_: