![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) ![]() |
![]() | Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
![]() | Protein automated matches [190418] (5 species) not a true protein |
![]() | Species Chryseobacterium indologenes [TaxId:253] [189306] (1 PDB entry) |
![]() | Domain d3l6na_: 3l6n A: [180005] automated match to d1m2xa_ complexed with so4, zn |
PDB Entry: 3l6n (more details), 1.65 Å
SCOPe Domain Sequences for d3l6na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l6na_ d.157.1.0 (A:) automated matches {Chryseobacterium indologenes [TaxId: 253]} qvkdfvieppiknnlhiyktfgvfggkeysansmylvtkkgvvlfdvpwekvqyqslmdt ikkrhnlpvvavfathshddragdlsffnnkgiktyataktneflkkdgkatsteiiktg kpyriggeefvvdflgeghtadnvvvwfpkynvldggclvksnsatdlgyikeanveqwp ktinklkakyskatliipghdewkggghvehtlellnk
Timeline for d3l6na_: