Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (203 species) not a true protein |
Species Aeromonas hydrophila [TaxId:380703] [189227] (1 PDB entry) |
Domain d3l6eb_: 3l6e B: [180004] automated match to d2bd0a1 complexed with so4 |
PDB Entry: 3l6e (more details), 2.3 Å
SCOPe Domain Sequences for d3l6eb_:
Sequence, based on SEQRES records: (download)
>d3l6eb_ c.2.1.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]} lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe dvdvafaaavewgglpelvlhcagtgefgpvgvytaeqirrvmesnlvstilvaqqtvrl igerggvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgir sefwdntdhvdpsgfmtpedaaaymldalearsschvtdlfigrne
>d3l6eb_ c.2.1.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]} lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe dvdvafaaavewgglpelvlhcagtgefytaeqirrvmesnlvstilvaqqtvrligerg gvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirseffm tpedaaaymldalearsschvtdlfigrne
Timeline for d3l6eb_: