SCOPe 2.04: Domain d3l6eb_: 3l6e B:

Lineage for d3l6eb_ (3l6e B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (181 species)
   not a true protein

7. Species Aeromonas hydrophila [TaxId:380703] [189227] (1 PDB entry)

8. Domain d3l6eb_: 3l6e B: [180004]
   automated match to d2bd0a1
   complexed with so4

Details for d3l6eb_

PDB Entry: 3l6e, 2.3 Å

PDB Description: crystal structure of putative short chain dehydrogenase/reductase family oxidoreductase from aeromonas hydrophila subsp. hydrophila atcc 7966

PDB Compounds: (B:) Oxidoreductase, short-chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3l6eb_:

Sequence, based on SEQRES records:

>d3l6eb_ c.2.1.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]}
lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe
dvdvafaaavewgglpelvlhcagtgefgpvgvytaeqirrvmesnlvstilvaqqtvrl
igerggvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgir
sefwdntdhvdpsgfmtpedaaaymldalearsschvtdlfigrne

Sequence, based on observed residues (ATOM records):

>d3l6eb_ c.2.1.0 (B:) automated matches {Aeromonas hydrophila [TaxId: 380703]}
lghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhe
dvdvafaaavewgglpelvlhcagtgefytaeqirrvmesnlvstilvaqqtvrligerg
gvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirseffm
tpedaaaymldalearsschvtdlfigrne

Timeline for d3l6eb_:

• d3l6eb_ first appeared in SCOPe 2.01
  
• d3l6eb_ appears in SCOPe 2.03
  
• d3l6eb_ appears in SCOPe 2.05
  
• d3l6eb_ appears in the current release, SCOPe 2.08, called d3l6eb1