Lineage for d3l6eb1 (3l6e B:4-227)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2845861Species Aeromonas hydrophila [TaxId:380703] [189227] (1 PDB entry)
  8. 2845863Domain d3l6eb1: 3l6e B:4-227 [180004]
    Other proteins in same PDB: d3l6ea2, d3l6ea3, d3l6eb2, d3l6eb3
    automated match to d2bd0a1
    complexed with so4

Details for d3l6eb1

PDB Entry: 3l6e (more details), 2.3 Å

PDB Description: crystal structure of putative short chain dehydrogenase/reductase family oxidoreductase from aeromonas hydrophila subsp. hydrophila atcc 7966
PDB Compounds: (B:) Oxidoreductase, short-chain dehydrogenase/reductase family

SCOPe Domain Sequences for d3l6eb1:

Sequence, based on SEQRES records: (download)

>d3l6eb1 c.2.1.0 (B:4-227) automated matches {Aeromonas hydrophila [TaxId: 380703]}
ghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhed
vdvafaaavewgglpelvlhcagtgefgpvgvytaeqirrvmesnlvstilvaqqtvrli
gerggvlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirs
efwdntdhvdpsgfmtpedaaaymldalearsschvtdlfigrn

Sequence, based on observed residues (ATOM records): (download)

>d3l6eb1 c.2.1.0 (B:4-227) automated matches {Aeromonas hydrophila [TaxId: 380703]}
ghiivtgagsglgraltiglverghqvsmmgrryqrlqqqelllgnavigivadlahhed
vdvafaaavewgglpelvlhcagtgefytaeqirrvmesnlvstilvaqqtvrligergg
vlanvlssaaqvgkaneslycaskwgmrgfleslraelkdsplrlvnlypsgirseffmt
pedaaaymldalearsschvtdlfigrn

SCOPe Domain Coordinates for d3l6eb1:

Click to download the PDB-style file with coordinates for d3l6eb1.
(The format of our PDB-style files is described here.)

Timeline for d3l6eb1: