Lineage for d3l65a_ (3l65 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2414849Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2415386Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2415387Protein automated matches [190048] (22 species)
    not a true protein
  7. 2415478Species Pseudomonas putida [TaxId:303] [187793] (24 PDB entries)
  8. 2415481Domain d3l65a_: 3l65 A: [179998]
    automated match to d1z41a1
    complexed with bu3, fmn, so4; mutant

Details for d3l65a_

PDB Entry: 3l65 (more details), 1.2 Å

PDB Description: Xenobiotic Reductase A - C25A Mutant
PDB Compounds: (A:) Xenobiotic reductase A

SCOPe Domain Sequences for d3l65a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l65a_ c.1.4.0 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
salfepytlkdvtlrnriaippmaqymaedgmindwhhvhlaglarggagllvveatava
pegritpgcagiwsdahaqafvpvvqaikaagsvpgiqiahagrkasanrpwegddhiaa
ddtrgwetiapsaiafgahlpkvpremtlddiarvkqdfvdaarrardagfewielhfah
gylgqsffsehsnkrtdayggsfdnrsrflletlaavrevwpenlpltarfgvleydgrd
eqtleesielarrfkaggldllsvsvgftipdtnipwgpafmgpiaervrreaklpvtsa
wgfgtpqlaeaalqanqldlvsvgrahladphwayfaakelgvekaswtlpapyahwler
y

SCOPe Domain Coordinates for d3l65a_:

Click to download the PDB-style file with coordinates for d3l65a_.
(The format of our PDB-style files is described here.)

Timeline for d3l65a_: