Lineage for d3l60a_ (3l60 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130379Fold c.43: CoA-dependent acyltransferases [52776] (1 superfamily)
    core: 2 layers, a/b; mixed beta-sheet of 6 strands, order 324561; strands 3 & 6 are antiparallel to the rest
  4. 2130380Superfamily c.43.1: CoA-dependent acyltransferases [52777] (5 families) (S)
  5. 2130565Family c.43.1.0: automated matches [191456] (1 protein)
    not a true family
  6. 2130566Protein automated matches [190703] (6 species)
    not a true protein
  7. 2130612Species Mycobacterium tuberculosis [TaxId:1773] [189181] (1 PDB entry)
  8. 2130613Domain d3l60a_: 3l60 A: [179993]
    automated match to d1b5sa_
    complexed with unl

Details for d3l60a_

PDB Entry: 3l60 (more details), 2 Å

PDB Description: crystal structure of branched-chain alpha-keto acid dehydrogenase subunit e2 from mycobacterium tuberculosis
PDB Compounds: (A:) branched-chain alpha-keto acid dehydrogenase

SCOPe Domain Sequences for d3l60a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l60a_ c.43.1.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
pdvrpvhgvharmaekmtlshkeiptakasvevicaellrlrdrfvsaapeitpfaltlr
llvialkhnvilnstwvdsgegpqvhvhrgvhlgfgaatergllvpvvtdaqdkntrela
srvaelitgaregtltpaelrgstftvsnfgalgvddgvpvinhpeaailglgaikprpv
vvggevvarptmtltcvfdhrvvdgaqvaqfmcelrdliespetalldl

SCOPe Domain Coordinates for d3l60a_:

Click to download the PDB-style file with coordinates for d3l60a_.
(The format of our PDB-style files is described here.)

Timeline for d3l60a_: