![]() | Class a: All alpha proteins [46456] (284 folds) |
![]() | Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
![]() | Superfamily a.26.1: 4-helical cytokines [47266] (3 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
![]() | Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
![]() | Protein Interleukin-13 (IL-13) [63532] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [63533] (6 PDB entries) |
![]() | Domain d3l5xa_: 3l5x A: [179989] automated match to d1ijza_ complexed with gol, mes |
PDB Entry: 3l5x (more details), 1.9 Å
SCOPe Domain Sequences for d3l5xa_:
Sequence, based on SEQRES records: (download)
>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]} stalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrm lsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr
>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]} stalrelieelvnitqplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsgf cphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr
Timeline for d3l5xa_: