Lineage for d3l5xa_ (3l5x A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 912412Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 912413Superfamily a.26.1: 4-helical cytokines [47266] (3 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 912488Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 912507Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 912508Species Human (Homo sapiens) [TaxId:9606] [63533] (6 PDB entries)
  8. 912509Domain d3l5xa_: 3l5x A: [179989]
    automated match to d1ijza_
    complexed with gol, mes

Details for d3l5xa_

PDB Entry: 3l5x (more details), 1.9 Å

PDB Description: crystal structure of the complex between il-13 and h2l6 fab
PDB Compounds: (A:) interleukin-13

SCOPe Domain Sequences for d3l5xa_:

Sequence, based on SEQRES records: (download)

>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrm
lsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr

Sequence, based on observed residues (ATOM records): (download)

>d3l5xa_ a.26.1.2 (A:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqplcngsmvwsinltagmycaaleslinvsgcsaiektqrmlsgf
cphkvsagqfsslhvrdtkievaqfvkdlllhlkklfregr

SCOPe Domain Coordinates for d3l5xa_:

Click to download the PDB-style file with coordinates for d3l5xa_.
(The format of our PDB-style files is described here.)

Timeline for d3l5xa_: