Lineage for d3l5wj_ (3l5w J:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2705447Fold a.26: 4-helical cytokines [47265] (1 superfamily)
    core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections
  4. 2705448Superfamily a.26.1: 4-helical cytokines [47266] (4 families) (S)
    there are two different topoisomers of this fold with different entanglements of the two crossover connections
  5. 2705548Family a.26.1.2: Short-chain cytokines [47286] (14 proteins)
  6. 2705579Protein Interleukin-13 (IL-13) [63532] (1 species)
  7. 2705580Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries)
  8. 2705583Domain d3l5wj_: 3l5w J: [179988]
    Other proteins in same PDB: d3l5wa1, d3l5wa2, d3l5wb_, d3l5wh_, d3l5wl1, d3l5wl2
    automated match to d1ijza_
    complexed with gol

Details for d3l5wj_

PDB Entry: 3l5w (more details), 2 Å

PDB Description: Crystal structure of the complex between IL-13 and C836 FAB
PDB Compounds: (J:) interleukin-13

SCOPe Domain Sequences for d3l5wj_:

Sequence, based on SEQRES records: (download)

>d3l5wj_ a.26.1.2 (J:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrm
lsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfreg

Sequence, based on observed residues (ATOM records): (download)

>d3l5wj_ a.26.1.2 (J:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqlcngsmvwsinltmycaaleslinvsgcsaiektqrmlsgfcph
kvsakievaqfvkdlllhlkklfreg

SCOPe Domain Coordinates for d3l5wj_:

Click to download the PDB-style file with coordinates for d3l5wj_.
(The format of our PDB-style files is described here.)

Timeline for d3l5wj_: