| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.26: 4-helical cytokines [47265] (1 superfamily) core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections |
Superfamily a.26.1: 4-helical cytokines [47266] (4 families) ![]() there are two different topoisomers of this fold with different entanglements of the two crossover connections |
| Family a.26.1.2: Short-chain cytokines [47286] (14 proteins) |
| Protein Interleukin-13 (IL-13) [63532] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [63533] (13 PDB entries) |
| Domain d3l5wj_: 3l5w J: [179988] Other proteins in same PDB: d3l5wa1, d3l5wa2, d3l5wb_, d3l5wh_, d3l5wl1, d3l5wl2 automated match to d1ijza_ complexed with gol |
PDB Entry: 3l5w (more details), 2 Å
SCOPe Domain Sequences for d3l5wj_:
Sequence, based on SEQRES records: (download)
>d3l5wj_ a.26.1.2 (J:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqnqkaplcngsmvwsinltagmycaaleslinvsgcsaiektqrm
lsgfcphkvsagqfsslhvrdtkievaqfvkdlllhlkklfreg
>d3l5wj_ a.26.1.2 (J:) Interleukin-13 (IL-13) {Human (Homo sapiens) [TaxId: 9606]}
stalrelieelvnitqlcngsmvwsinltmycaaleslinvsgcsaiektqrmlsgfcph
kvsakievaqfvkdlllhlkklfreg
Timeline for d3l5wj_: