Lineage for d3l5ua_ (3l5u A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915130Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 1915131Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 1915295Family d.80.1.3: MIF-related [55339] (2 proteins)
    automatically mapped to Pfam PF01187
  6. 1915312Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 1915318Species Human (Homo sapiens) [TaxId:9606] [55341] (59 PDB entries)
  8. 1915406Domain d3l5ua_: 3l5u A: [179981]
    automated match to d1gcza_
    complexed with so4, zec

Details for d3l5ua_

PDB Entry: 3l5u (more details), 1.9 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with benzothiazole inhibitor at 1.90a resolution
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3l5ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5ua_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfale

SCOPe Domain Coordinates for d3l5ua_:

Click to download the PDB-style file with coordinates for d3l5ua_.
(The format of our PDB-style files is described here.)

Timeline for d3l5ua_: