SCOPe 2.05: Domain d3l5ta_: 3l5t A:

Lineage for d3l5ta_ (3l5t A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (2 proteins)
   automatically mapped to Pfam PF01187

6. Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (59 PDB entries)

8. Domain d3l5ta_: 3l5t A: [179978]
   automated match to d1gcza_
   complexed with 956, so4

Details for d3l5ta_

PDB Entry: 3l5t, 1.86 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with thiophenepiperazinylquinolinone inhibitor at 1.86a resolution

PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3l5ta_:

Sequence; same for both SEQRES and ATOM records:

>d3l5ta_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d3l5ta_:

• d3l5ta_ first appeared in SCOPe 2.01
  
• d3l5ta_ appears in SCOPe 2.04
  
• d3l5ta_ appears in SCOPe 2.06
  
• d3l5ta_ appears in the current release, SCOPe 2.08