| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.80: Tautomerase/MIF [55330] (1 superfamily) (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet generally forms trimers with three closely packed beta-sheets |
Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) ![]() |
| Family d.80.1.3: MIF-related [55339] (3 proteins) automatically mapped to Pfam PF01187 |
| Protein Microphage migration inhibition factor (MIF) [55340] (7 species) synonym: glycosylation-inhibiting factor (GIF) |
| Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries) |
| Domain d3l5sa_: 3l5s A: [179975] Other proteins in same PDB: d3l5sb2, d3l5sc2 automated match to d1gcza_ complexed with 88x, so4 |
PDB Entry: 3l5s (more details), 1.86 Å
SCOPe Domain Sequences for d3l5sa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l5sa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa
Timeline for d3l5sa_:
View in 3DDomains from other chains: (mouse over for more information) d3l5sb1, d3l5sb2, d3l5sc1, d3l5sc2 |