SCOPe 2.07: Domain d3l5rb1: 3l5r B:1-114

Lineage for d3l5rb1 (3l5r B:1-114)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
   (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
   generally forms trimers with three closely packed beta-sheets

4. Superfamily d.80.1: Tautomerase/MIF [55331] (7 families)

5. Family d.80.1.3: MIF-related [55339] (3 proteins)
   automatically mapped to Pfam PF01187

6. Protein Microphage migration inhibition factor (MIF) [55340] (8 species)
   synonym: glycosylation-inhibiting factor (GIF)

7. Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)

8. Domain d3l5rb1: 3l5r B:1-114 [179973]
   Other proteins in same PDB: d3l5rb2, d3l5rc2
   automated match to d1gcza_
   complexed with 47x, gol, so4

Details for d3l5rb1

PDB Entry: 3l5r, 1.94 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with phenylchromenone inhibitor at 1.94a resolution

PDB Compounds: (B:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3l5rb1:

Sequence; same for both SEQRES and ATOM records:

>d3l5rb1 d.80.1.3 (B:1-114) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

Timeline for d3l5rb1:

• d3l5rb1 first appeared in SCOPe 2.01, called d3l5rb_
  
• d3l5rb1 appears in SCOPe 2.06
  
• d3l5rb1 appears in the current release, SCOPe 2.08