Lineage for d3l5pa_ (3l5p A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2960762Fold d.80: Tautomerase/MIF [55330] (1 superfamily)
    (beta-alpha-beta)2; 2 layers: alpha/beta; mixed beta-sheet
    generally forms trimers with three closely packed beta-sheets
  4. 2960763Superfamily d.80.1: Tautomerase/MIF [55331] (7 families) (S)
  5. 2961019Family d.80.1.3: MIF-related [55339] (3 proteins)
    automatically mapped to Pfam PF01187
  6. 2961039Protein Microphage migration inhibition factor (MIF) [55340] (7 species)
    synonym: glycosylation-inhibiting factor (GIF)
  7. 2961045Species Human (Homo sapiens) [TaxId:9606] [55341] (94 PDB entries)
  8. 2961210Domain d3l5pa_: 3l5p A: [179969]
    Other proteins in same PDB: d3l5pb2, d3l5pc2
    automated match to d1gcza_
    complexed with 428, gol, so4

Details for d3l5pa_

PDB Entry: 3l5p (more details), 1.8 Å

PDB Description: crystal structure of macrophage migration inhibitory factor (mif) with imidazopyridazinol inhibitor at 1.80a resolution
PDB Compounds: (A:) macrophage migration inhibitory factor

SCOPe Domain Sequences for d3l5pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5pa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Human (Homo sapiens) [TaxId: 9606]}
pmfivntnvprasvpdgflseltqqlaqatgkppqyiavhvvpdqlmafggssepcalcs
lhsigkiggaqnrsyskllcgllaerlrispdrvyinyydmnaanvgwnnstfa

SCOPe Domain Coordinates for d3l5pa_:

Click to download the PDB-style file with coordinates for d3l5pa_.
(The format of our PDB-style files is described here.)

Timeline for d3l5pa_: