Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
Superfamily c.67.3: Dhaf3308-like [159713] (1 family) not known to bind PLP cofactor; the extra N-terminal subdomain has a enolase N-terminal domain-like fold (54825) |
Family c.67.3.1: Dhaf3308-like [159714] (1 protein) Pfam PF04016; DUF364 |
Protein Hypothetical protein Dhaf_3308 [159715] (1 species) |
Species Desulfitobacterium hafniense [TaxId:49338] [159716] (2 PDB entries) Uniprot Q18YZ7 1-251 |
Domain d3l5ob1: 3l5o B:1-251 [179968] Other proteins in same PDB: d3l5oa2, d3l5ob2 automated match to d3l5oa_ complexed with cl, edo, imd |
PDB Entry: 3l5o (more details), 2.01 Å
SCOPe Domain Sequences for d3l5ob1:
Sequence, based on SEQRES records: (download)
>d3l5ob1 c.67.3.1 (B:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} mweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllglpl rvaagcvkswnyveasiglaainayynnpqvarehgvifsdakrvedrmndpfimsqnev kgkkvgvvghfphlesllepicdlsilewspeegdyplpasefilpecdyvyitcasvvd ktlprllelsrnarritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaekvki ysagqkvtikk
>d3l5ob1 c.67.3.1 (B:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]} mweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllglpl rvaagcvkswnyveasiglaainayynnpqvarehgvifsdamsqnevkgkkvgvvghfp hlesllepicdlsilewspeegdyplpasefilpecdyvyitcasvvdktlprllelsrn arritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaekvkiysagqkvtikk
Timeline for d3l5ob1: