SCOPe 2.08: Domain d3l5ob1: 3l5o B:1-251

Lineage for d3l5ob1 (3l5o B:1-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.3: Dhaf3308-like [159713] (1 family)
   not known to bind PLP cofactor; the extra N-terminal subdomain has a enolase N-terminal domain-like fold (54825)

5. Family c.67.3.1: Dhaf3308-like [159714] (1 protein)
   Pfam PF04016; DUF364

6. Protein Hypothetical protein Dhaf_3308 [159715] (1 species)

7. Species Desulfitobacterium hafniense [TaxId:49338] [159716] (2 PDB entries)
   Uniprot Q18YZ7 1-251

8. Domain d3l5ob1: 3l5o B:1-251 [179968]
   Other proteins in same PDB: d3l5oa2, d3l5ob2
   automated match to d3l5oa_
   complexed with cl, edo, imd

Details for d3l5ob1

PDB Entry: 3l5o, 2.01 Å

PDB Description: crystal structure of protein with unknown function from duf364 family (zp_00559375.1) from desulfitobacterium hafniense dcb-2 at 2.01 a resolution

PDB Compounds: (B:) uncharacterized protein from DUF364 family

SCOPe Domain Sequences for d3l5ob1:

Sequence, based on SEQRES records:

>d3l5ob1 c.67.3.1 (B:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]}
mweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllglpl
rvaagcvkswnyveasiglaainayynnpqvarehgvifsdakrvedrmndpfimsqnev
kgkkvgvvghfphlesllepicdlsilewspeegdyplpasefilpecdyvyitcasvvd
ktlprllelsrnarritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaekvki
ysagqkvtikk

Sequence, based on observed residues (ATOM records):

>d3l5ob1 c.67.3.1 (B:1-251) Hypothetical protein Dhaf_3308 {Desulfitobacterium hafniense [TaxId: 49338]}
mweiydamingipedflvdelvcgtthsvirsgngvglgpnrpfetrmpmltqnllglpl
rvaagcvkswnyveasiglaainayynnpqvarehgvifsdamsqnevkgkkvgvvghfp
hlesllepicdlsilewspeegdyplpasefilpecdyvyitcasvvdktlprllelsrn
arritlvgpgtplapvlfehglqelsgfmvkdnarafrivagaekvkiysagqkvtikk

Timeline for d3l5ob1:

• d3l5ob1 first appeared in SCOPe 2.01, called d3l5ob_
  
• d3l5ob1 appears in SCOPe 2.07