Lineage for d3l5fb_ (3l5f B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2060177Family b.50.1.2: Pepsin-like [50646] (11 protein domains)
    duplication: consists of two similar barrel domains
    N-terminal: barrel, partly opened; n*=6, S*=10
  6. 2060235Protein beta-secretase (memapsin) [50671] (1 species)
  7. 2060236Species Human (Homo sapiens) [TaxId:9606] [50672] (281 PDB entries)
    Uniprot P56817 58-446 ! Uniprot P56817 60-447
  8. 2060261Domain d3l5fb_: 3l5f B: [179964]
    automated match to d1fkna_
    complexed with bdx, tar

Details for d3l5fb_

PDB Entry: 3l5f (more details), 1.7 Å

PDB Description: structure of bace bound to sch736201
PDB Compounds: (B:) Beta-secretase 1

SCOPe Domain Sequences for d3l5fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l5fb_ b.50.1.2 (B:) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]}
gsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqrql
sstyrdlrkgvyvpytqgkwegelgtdlvsiphgpnvtvraniaaitesdkffingsnwe
gilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfplnqsevlasvggsmii
ggidhslytgslwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrl
pkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsf
ritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfav
sachvhdefrtaavegpfvtldmedcgyn

SCOPe Domain Coordinates for d3l5fb_:

Click to download the PDB-style file with coordinates for d3l5fb_.
(The format of our PDB-style files is described here.)

Timeline for d3l5fb_: