Lineage for d3l57b_ (3l57 B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963164Fold d.89: Origin of replication-binding domain, RBD-like [55463] (1 superfamily)
    alpha-beta-alpha-beta(2)-alpha-beta-alpha-beta; 3 layers: a/b/a; antiparallel sheet 41325
  4. 2963165Superfamily d.89.1: Origin of replication-binding domain, RBD-like [55464] (6 families) (S)
  5. 2963262Family d.89.1.0: automated matches [191630] (1 protein)
    not a true family
  6. 2963263Protein automated matches [191159] (3 species)
    not a true protein
  7. 2963264Species Escherichia coli [TaxId:562] [189342] (2 PDB entries)
  8. 2963266Domain d3l57b_: 3l57 B: [179950]
    automated match to d1omha_
    complexed with cit, edo, mn3, po4

Details for d3l57b_

PDB Entry: 3l57 (more details), 2.29 Å

PDB Description: Crystal Structure of the Plasmid pCU1 TraI Relaxase Domain
PDB Compounds: (B:) Mobilization protein TraI

SCOPe Domain Sequences for d3l57b_:

Sequence, based on SEQRES records: (download)

>d3l57b_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mldittitrqnvtsvvgyysdakddyyskdssftswqgtgaealglsgdvesarfkellv
geidtfthmqrhvgdakkerlgydltfsapkgvsmqalihgdktiieahekavaaavrea
eklaqarttrqgksvtqntnnlvvatfrhetsraldpdlhthafvmnmtqredgqwralk
ndelmrnkmhlgdvykqelaleltkagyelrynsknntfdmah

Sequence, based on observed residues (ATOM records): (download)

>d3l57b_ d.89.1.0 (B:) automated matches {Escherichia coli [TaxId: 562]}
mldittitrqnvtsvvgftswqgtgaealglsgdvesarfkellvgeidtfthmqrhkke
rlgydltfsapkgvsmqalihgdktiieahekavaaavreaeklaqarttrqgksvtqnt
nnlvvatfrhetsrldpdlhthafvmnmtqredgqwralkndelmrnkmhlgdvykqela
leltkagyelrynsknntfdmah

SCOPe Domain Coordinates for d3l57b_:

Click to download the PDB-style file with coordinates for d3l57b_.
(The format of our PDB-style files is described here.)

Timeline for d3l57b_: