Lineage for d3l4pa4 (3l4p A:311-907)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1041184Fold d.133: Molybdenum cofactor-binding domain [56002] (1 superfamily)
    beta(2)-alpha-beta-alpha-beta; 2 layers: a/b; mixed sheet: order 1243: crossing loops
  4. 1041185Superfamily d.133.1: Molybdenum cofactor-binding domain [56003] (1 family) (S)
    duplication: consists of 4 structural repeats arranged in 2 lobes
    contains one left-hand beta-alpha-beta unit per lobe
  5. 1041186Family d.133.1.1: Molybdenum cofactor-binding domain [56004] (6 proteins)
  6. 1041193Protein Aldehyde oxidoreductase [56005] (2 species)
  7. 1041196Species Desulfovibrio gigas [TaxId:879] [56006] (3 PDB entries)
    Uniprot Q46509
  8. 1041198Domain d3l4pa4: 3l4p A:311-907 [179945]
    Other proteins in same PDB: d3l4pa1, d3l4pa2, d3l4pa3
    automatically matched to d1sija4
    complexed with ast, ca, cl, fes, ipa, li, mg, pcd, ure

Details for d3l4pa4

PDB Entry: 3l4p (more details), 1.45 Å

PDB Description: crystal structure of the aldehyde dehydrogenase (a.k.a. aor or mop) of desulfovibrio gigas covalently bound to [aso3]-
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3l4pa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4pa4 d.133.1.1 (A:311-907) Aldehyde oxidoreductase {Desulfovibrio gigas [TaxId: 879]}
msgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyvgrqphmpiep
dvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggtfgykfsptse
alvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllamesdwlvdhgp
ysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqsmfaseclmdm
laeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaalekaqkestat
hkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadigcvgtahealr
pmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkacekpgggyytyd
elkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdvatgqttvdgmt
lmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpfikqipdkldi
vyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypekvlealka

SCOPe Domain Coordinates for d3l4pa4:

Click to download the PDB-style file with coordinates for d3l4pa4.
(The format of our PDB-style files is described here.)

Timeline for d3l4pa4: