Lineage for d3l4oe_ (3l4o E:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1704092Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 1704093Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 1704094Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 1704115Protein automated matches [190303] (3 species)
    not a true protein
  7. 1704147Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)
  8. 1704173Domain d3l4oe_: 3l4o E: [179941]
    Other proteins in same PDB: d3l4od_, d3l4of_
    automated match to d1mg2b_
    complexed with 1pe, act, ca, hec, pg4

Details for d3l4oe_

PDB Entry: 3l4o (more details), 2.05 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
PDB Compounds: (E:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3l4oe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4oe_ g.21.1.1 (E:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3l4oe_:

Click to download the PDB-style file with coordinates for d3l4oe_.
(The format of our PDB-style files is described here.)

Timeline for d3l4oe_: