Lineage for d3l4oc_ (3l4o C:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2261162Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
    disulfide-rich; nearly all-beta
  4. 2261163Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families) (S)
  5. 2261164Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
    automatically mapped to Pfam PF02975
  6. 2261165Protein Methylamine dehydrogenase [57563] (2 species)
  7. 2261166Species Paracoccus denitrificans [TaxId:266] [57564] (24 PDB entries)
  8. 2261185Domain d3l4oc_: 3l4o C: [179940]
    Other proteins in same PDB: d3l4od_, d3l4of_
    automated match to d1mg2b_
    complexed with 1pe, act, ca, hec, pg4

Details for d3l4oc_

PDB Entry: 3l4o (more details), 2.05 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide
PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3l4oc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l4oc_ g.21.1.1 (C:) Methylamine dehydrogenase {Paracoccus denitrificans [TaxId: 266]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

SCOPe Domain Coordinates for d3l4oc_:

Click to download the PDB-style file with coordinates for d3l4oc_.
(The format of our PDB-style files is described here.)

Timeline for d3l4oc_: