SCOPe 2.03: Domain d3l4oc_: 3l4o C:

Lineage for d3l4oc_ (3l4o C:)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.21: Methylamine dehydrogenase, L chain [57560] (1 superfamily)
   disulfide-rich; nearly all-beta

4. Superfamily g.21.1: Methylamine dehydrogenase, L chain [57561] (2 families)

5. Family g.21.1.1: Methylamine dehydrogenase, L chain [57562] (2 proteins)
   automatically mapped to Pfam PF02975

6. Protein automated matches [190303] (2 species)
   not a true protein

7. Species Paracoccus denitrificans [TaxId:318586] [189284] (19 PDB entries)

8. Domain d3l4oc_: 3l4o C: [179940]
   Other proteins in same PDB: d3l4od_, d3l4of_
   automated match to d1mg2b_
   complexed with 1pe, act, ca, hec, pg4

Details for d3l4oc_

PDB Entry: 3l4o, 2.05 Å

PDB Description: crystal structure of the maug/pre-methylamine dehydrogenase complex after treatment with hydrogen peroxide

PDB Compounds: (C:) Methylamine dehydrogenase light chain

SCOPe Domain Sequences for d3l4oc_:

Sequence; same for both SEQRES and ATOM records:

>d3l4oc_ g.21.1.1 (C:) automated matches {Paracoccus denitrificans [TaxId: 318586]}
tdprakwvpqdndiqacdywrhcsidgnicdcsggsltncppgtklataswvascynptd
gqsyliayrdccgynvsgrcpclntegelpvyrpefandiiwcfgaeddamtyhctispi
vgkas

Timeline for d3l4oc_:

• d3l4oc_ first appeared in SCOPe 2.01
  
• d3l4oc_ appears in SCOPe 2.02
  
• d3l4oc_ appears in SCOPe 2.04
  
• d3l4oc_ appears in the current release, SCOPe 2.08